Recombinant Full Length Human BCAT1 Protein, C-Flag-tagged
Cat.No. : | BCAT1-907HFL |
Product Overview : | Recombinant Full Length Human BCAT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth. Two different clinical disorders have been attributed to a defect of branched-chain amino acid transamination: hypervalinemia and hyperleucine-isoleucinemia. As there is also a gene encoding a mitochondrial form of this enzyme, mutations in either gene may contribute to these disorders. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEK PHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLEC IQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSSGTFNPVSLWANPKY VRAWKGGTGDCKMGGNYGSSLFAQCEAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPP LDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETI HIPTMENGPKLASRILSKLTDIQYGREESDWTIVLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Pantothenate and CoA biosynthesis, Valine, leucine and isoleucine biosynthesis, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | BCAT1 branched chain amino acid transaminase 1 [ Homo sapiens (human) ] |
Official Symbol | BCAT1 |
Synonyms | BCT1; PP18; BCATC; ECA39; MECA39; PNAS121 |
Gene ID | 586 |
mRNA Refseq | NM_005504.7 |
Protein Refseq | NP_005495.2 |
MIM | 113520 |
UniProt ID | P54687 |
◆ Recombinant Proteins | ||
BCAT1-1043H | Recombinant Human BCAT1 protein, T7-His-TEV cleavage site-tagged | +Inquiry |
BCAT1-0244H | Recombinant Human BCAT1 Protein (K2-S386), Tag Free | +Inquiry |
Bcat1-693M | Recombinant Mouse Bcat1 Protein, MYC/DDK-tagged | +Inquiry |
BCAT1-0392H | Recombinant Human BCAT1 Protein (Gly174-Ser386), N-His-tagged | +Inquiry |
BCAT1-0245H | Recombinant Human BCAT1 Protein (K2-S386), His/Strep tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCAT1-8495HCL | Recombinant Human BCAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCAT1 Products
Required fields are marked with *
My Review for All BCAT1 Products
Required fields are marked with *
0
Inquiry Basket