Recombinant Full Length Human BCAP29 Protein, C-Flag-tagged

• Cat.No.: BCAP29-1686HFL
• Product Overview: Recombinant Full Length Human BCAP29 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Involved in osteoblast differentiation. Located in membrane.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 28.1 kDa
• AA Sequence: MTLQWAAVATFLYAEIGLILIFCLPFIPPQRWQKIFSFNVWGKIATFWNKAFLTIIILLIVLFLDAVREV RKYSSVHTIEKSSTSRPDAYEHTQMKLFRSQRNLYISGFSLFFWLVLRRLVTLITQLAKELSNKGVLKTQ AENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKM
  QSERLSKEYDQLLKEHSELQDRLERGNKKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: BCAP29 B cell receptor associated protein 29 [ Homo sapiens (human) ]
• Official Symbol: BCAP29
• Synonyms: B29; BAP29
• Gene ID: 55973
• mRNA Refseq: NM_018844.4
• Protein Refseq: NP_061332.2
• MIM: 619612
• UniProt ID: Q9UHQ4