Recombinant Full Length Human ATP6V1B2 Protein, C-Flag-tagged

• Cat.No.: ATP6V1B2-1223HFL
• Product Overview: Recombinant Full Length Human ATP6V1B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 56.3 kDa
• AA Sequence: MALRAMRGIVNGAAPELPVPTGGPAVGAQEQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAE IVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPID RGPVVLAEDFLDIMGQPINPQCRIYPEEMIRTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQA GLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALT TAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVGGRNGSITQ IPILTMPNDDITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIGWQLLRIFPKE
  MLKRIPQSTLSEFYPRDSAKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection
• Full Length: Full L.

Gene Information

• Gene Name: ATP6V1B2 ATPase H+ transporting V1 subunit B2 [ Homo sapiens (human) ]
• Official Symbol: ATP6V1B2
• Synonyms: DOOD; HO57; VATB; VPP3; Vma2; ZLS2; ATP6B2; ATP6B1B2
• Gene ID: 526
• mRNA Refseq: NM_001693.4
• Protein Refseq: NP_001684.2
• MIM: 606939
• UniProt ID: P21281