Recombinant Full Length Human ASPHD2 Protein, GST-tagged

• Cat.No.: ASPHD2-5909HF
• Product Overview: Human LOC57168 full-length ORF ( AAH36753, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 343 amino acids
• Description: ASPHD2 (Aspartate Beta-Hydroxylase Domain Containing 2) is a Protein Coding gene. GO annotations related to this gene include dioxygenase activity. An important paralog of this gene is ASPHD1.
• Molecular Mass: 63.47 kDa
• AA Sequence: MSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTAVITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNEGLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFSRDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQALDFIFAPGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASPHD2 aspartate beta-hydroxylase domain containing 2 [ Homo sapiens ]
• Official Symbol: ASPHD2
• Synonyms: ASPHD2; aspartate beta-hydroxylase domain containing 2; aspartate beta-hydroxylase domain-containing protein 2; FLJ39838
• Gene ID: 57168
• mRNA Refseq: NM_020437
• Protein Refseq: NP_065170
• UniProt ID: Q6ICH7