Recombinant Full Length Human ARRDC1 Protein, C-Flag-tagged
Cat.No. : | ARRDC1-1235HFL |
Product Overview : | Recombinant Full Length Human ARRDC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables several functions, including arrestin family protein binding activity; ubiquitin ligase-substrate adaptor activity; and ubiquitin protein ligase binding activity. Involved in several processes, including cellular protein metabolic process; extracellular vesicle biogenesis; and negative regulation of Notch signaling pathway. Located in cytoplasmic vesicle; extracellular vesicle; and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.8 kDa |
AA Sequence : | MGRVQLFEISLSHGRVVYSPGEPLAGTVRVRLGAPLPFRAIRVTCIGSCGVSNKANDTAWVVEEGYFNSS LSLADKGSLPAGEHSFPFQFLLPATAPTSFEGPFGKIVHQVRAAIHTPRFSKDHKCSLVFYILSPLNLNS IPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSY KAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVF IGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLDPVFLSTKSHSQRQPLLATLS SVPGAPEPCPQDGSPASHPLHPPLCISTGATVPYFAEGSGGPVPTTSTLILPPEYSSWGYPYEAPPSYEQ SCGGVEPSLTPESTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ARRDC1 arrestin domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | ARRDC1 |
Synonyms | RP11-48C7.5 |
Gene ID | 92714 |
mRNA Refseq | NM_152285.4 |
Protein Refseq | NP_689498.1 |
MIM | 619768 |
UniProt ID | Q8N5I2 |
◆ Recombinant Proteins | ||
ARRDC1-1506HF | Recombinant Full Length Human ARRDC1 Protein, GST-tagged | +Inquiry |
ARRDC1-381H | Recombinant Human ARRDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARRDC1-1977M | Recombinant Mouse ARRDC1 Protein | +Inquiry |
ARRDC1-856H | Recombinant Human ARRDC1 protein, GST-tagged | +Inquiry |
Arrdc1-1729M | Recombinant Mouse Arrdc1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRDC1-8678HCL | Recombinant Human ARRDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARRDC1 Products
Required fields are marked with *
My Review for All ARRDC1 Products
Required fields are marked with *
0
Inquiry Basket