Recombinant Full Length Human ARMS2 Protein, C-Flag-tagged

Cat.No. : ARMS2-1932HFL
Product Overview : Recombinant Full Length Human ARMS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 11.3 kDa
AA Sequence : MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens (human) ]
Official Symbol ARMS2
Synonyms ARMD8
Gene ID 387715
mRNA Refseq NM_001099667.3
Protein Refseq NP_001093137.1
MIM 611313
UniProt ID P0C7Q2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARMS2 Products

Required fields are marked with *

My Review for All ARMS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon