Recombinant Full Length Human ARMS2 Protein, C-Flag-tagged
Cat.No. : | ARMS2-1932HFL |
Product Overview : | Recombinant Full Length Human ARMS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a small secreted protein specific to primates. This protein is a component of the choroidal extracellular matrix of the eye. Mutations in this gene are associated with age-related macular degeneration. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 11.3 kDa |
AA Sequence : | MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAK IHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ARMS2 age-related maculopathy susceptibility 2 [ Homo sapiens (human) ] |
Official Symbol | ARMS2 |
Synonyms | ARMD8 |
Gene ID | 387715 |
mRNA Refseq | NM_001099667.3 |
Protein Refseq | NP_001093137.1 |
MIM | 611313 |
UniProt ID | P0C7Q2 |
◆ Recombinant Proteins | ||
ARMS2-3794H | Recombinant Human ARMS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARMS2-379H | Recombinant Human ARMS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARMS2-840H | Recombinant Human ARMS2 protein, GST-tagged | +Inquiry |
ARMS2-1932HFL | Recombinant Full Length Human ARMS2 Protein, C-Flag-tagged | +Inquiry |
ARMS2-3237H | Recombinant Human ARMS2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMS2-8693HCL | Recombinant Human ARMS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARMS2 Products
Required fields are marked with *
My Review for All ARMS2 Products
Required fields are marked with *
0
Inquiry Basket