Recombinant Full Length Human Apelin Receptor(Aplnr) Protein, His-Tagged
Cat.No. : | RFL-5360HF |
Product Overview : | Recombinant Full Length Human Apelin receptor(APLNR) Protein (P35414) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREK RRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCL TGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQ CYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGL RKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDLFLMNIFPYCTCISYV NSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGHSQGPGPNMGK GGEQMHEKSIPYSQETLVVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | APLNR |
Synonyms | APLNR; AGTRL1; APJ; Apelin receptor; Angiotensin receptor-like 1; G-protein coupled receptor APJ; G-protein coupled receptor HG11 |
UniProt ID | P35414 |
◆ Recombinant Proteins | ||
APLNR-3550H | Recombinant Human APLNR, His-tagged | +Inquiry |
APLNR-686H | Recombinant Human APLNR protein | +Inquiry |
RFL-27313MF | Recombinant Full Length Macaca Mulatta Apelin Receptor(Aplnr) Protein, His-Tagged | +Inquiry |
APLNR-0967H | Recombinant Human APLNR Protein (M1-R330), Flag, His tagged | +Inquiry |
APLNR-449H | Recombinant Human APLNR Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APLNR-8791HCL | Recombinant Human APLNR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APLNR Products
Required fields are marked with *
My Review for All APLNR Products
Required fields are marked with *
0
Inquiry Basket