Recombinant Full Length Human AOAH Protein, C-Flag-tagged
Cat.No. : | AOAH-546HFL |
Product Overview : | Recombinant Full Length Human AOAH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This locus encodes both the light and heavy subunits of acyloxyacyl hydrolase. The encoded enzyme catalyzes the hydrolysis of acyloxylacyl-linked fatty acyl chains from bacterial lipopolysaccharides, effectively detoxifying these molecules. The encoded protein may play a role in modulating host inflammatory response to gram-negative bacteria. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.5 kDa |
AA Sequence : | MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLC SYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKA RQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSD ESVYPGRRPNNWDVHQDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQM SLNSFINLPTALTNELDWPQLSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKF IESLSRNKVLDYPAIVIYAMIGNDVCSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPD GTFLWDNLHNRYHPLGQLNKDMTYAQLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAAS EKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENP FNPQIKQVFGDQGGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | AOAH acyloxyacyl hydrolase [ Homo sapiens (human) ] |
Official Symbol | AOAH |
Synonyms | acyloxyacyl hydrolase; acyloxyacyl hydrolase (neutrophil) |
Gene ID | 313 |
mRNA Refseq | NM_001637.4 |
Protein Refseq | NP_001628.1 |
MIM | 102593 |
UniProt ID | P28039 |
◆ Recombinant Proteins | ||
AOAH-10H | Recombinant Human AOAH Protein, GST-tag | +Inquiry |
AOAH-9703H | Recombinant Human AOAH, GST-tagged | +Inquiry |
AOAH-0398H | Recombinant Human AOAH Protein (Ser24-Gln300), His-tagged | +Inquiry |
AOAH-9382H | Recombinant Human AOAH Protein, MYC/DDK-tagged | +Inquiry |
AOAH-589M | Recombinant Mouse AOAH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AOAH-8824HCL | Recombinant Human AOAH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AOAH Products
Required fields are marked with *
My Review for All AOAH Products
Required fields are marked with *
0
Inquiry Basket