Recombinant Full Length Human ANXA11 Protein, C-Flag-tagged
Cat.No. : | ANXA11-1121HFL |
Product Overview : | Recombinant Full Length Human ANXA11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Several transcript variants encoding two different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.2 kDa |
AA Sequence : | MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANM PNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQP PGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLR KAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYE IKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDEST NVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEE GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTS GDYRKILLKICGGNDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ANXA11 annexin A11 [ Homo sapiens (human) ] |
Official Symbol | ANXA11 |
Synonyms | ALS23; ANX11; CAP50; CAP-50; IBMWMA |
Gene ID | 311 |
mRNA Refseq | NM_001157.3 |
Protein Refseq | NP_001148.1 |
MIM | 602572 |
UniProt ID | P50995 |
◆ Recombinant Proteins | ||
ANXA11-1121HFL | Recombinant Full Length Human ANXA11 Protein, C-Flag-tagged | +Inquiry |
Anxa11-3493M | Recombinant Mouse Anxa11, His-tagged | +Inquiry |
ANXA11-9693H | Recombinant Human ANXA11, GST-tagged | +Inquiry |
ANXA11-6905H | Recombinant Human Annexin A11, His-tagged | +Inquiry |
ANXA11-3250H | Recombinant Human ANXA11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA11-8837HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
ANXA11-8836HCL | Recombinant Human ANXA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANXA11 Products
Required fields are marked with *
My Review for All ANXA11 Products
Required fields are marked with *
0
Inquiry Basket