Recombinant Full Length Human AMHR2 Protein, C-Flag-tagged
Cat.No. : | AMHR2-1501HFL |
Product Overview : | Recombinant Full Length Human AMHR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.6 kDa |
AA Sequence : | MLGSLGLWALLPTAVEAPPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQD RAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAA PGESIWMALVLLGLFLLLLLLLGSIILALLQRKNYRVRGEPVPEPRPDSGRDWSVELQELPELCFSQQVI REGGHAVVWAGQLQGKLVAIKAFPPRSVAQFQAERALYELPGLQHDHIVRFITASRGGPGRLLSGPLLVL ELHPKGSLCHYLTQYTSDWGSSLRMALSLAQGLAFLHEERWQNGQNKPGIAHRDLSSQNVLIREDGSCAI GDLGLALVLPGLTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE ILSRCPDLRPDSSPPPFQLAYEAELGNTPTSDELWALAVQERRRPYIPSTWRCFATDPDGLRELLEDCWD ADPEARLTAECVQQRLAALAHPQESHPFPESCPRGCPPLCPEDCTSIPAPTILPCRPQRSACHFSVQQGP CSRNPQPACTLSPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | AMHR2 anti-Mullerian hormone receptor type 2 [ Homo sapiens (human) ] |
Official Symbol | AMHR2 |
Synonyms | AMHR; MRII; MISR2; MISRII |
Gene ID | 269 |
mRNA Refseq | NM_020547.3 |
Protein Refseq | NP_065434.1 |
MIM | 600956 |
UniProt ID | Q16671 |
◆ Recombinant Proteins | ||
AMHR2-0489C | Recombinant Cynomolgus AMHR2 protein, His-tagged | +Inquiry |
AMHR2-0487M | Recombinant Mouse AMHR2 protein, His-tagged | +Inquiry |
AMHR2-5601H | Active Recombinant Human Anti-Mullerian Hormone Receptor, Type II, Fc-tagged | +Inquiry |
AMHR2-7685H | Recombinant Human AMHR2 protein | +Inquiry |
AMHR2-0488H | Recombinant Human AMHR2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AMHR2-651R | Recombinant Rat AMHR2 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMHR2-8883HCL | Recombinant Human AMHR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMHR2 Products
Required fields are marked with *
My Review for All AMHR2 Products
Required fields are marked with *
0
Inquiry Basket