Recombinant Full Length Human ALOX15 Protein, C-Flag-tagged
Cat.No. : | ALOX15-644HFL |
Product Overview : | Recombinant Full Length Human ALOX15 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the lipoxygenase family of proteins. The encoded enzyme acts on various polyunsaturated fatty acid substrates to generate various bioactive lipid mediators such as eicosanoids, hepoxilins, lipoxins, and other molecules. The encoded enzyme and its reaction products have been shown to regulate inflammation and immunity. Multiple pseudogenes of this gene have been identified in the human genome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 74.6 kDa |
AA Sequence : | MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHL LKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYR WGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCG QSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSS DFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVK DDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREEL AALDKEIEIRNAKLDMPYEYLRPSVVENSVAITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arachidonic acid metabolism, Linoleic acid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens (human) ] |
Official Symbol | ALOX15 |
Synonyms | LOG15; 12-LOX; 15-LOX; 15-LOX-1 |
Gene ID | 246 |
mRNA Refseq | NM_001140.5 |
Protein Refseq | NP_001131.3 |
MIM | 152392 |
UniProt ID | P16050 |
◆ Recombinant Proteins | ||
ALOX15-20HF | Recombinant Full Length Human ALOX15 Protein | +Inquiry |
ALOX15-292R | Recombinant Rat ALOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX15-7892H | Recombinant Human ALOX15 protein, His-tagged | +Inquiry |
ALOX15-4696H | Recombinant Human ALOX15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALOX15-636R | Recombinant Rat ALOX15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX15 Products
Required fields are marked with *
My Review for All ALOX15 Products
Required fields are marked with *
0
Inquiry Basket