Recombinant Full Length Human AKR1B1 Protein, C-Flag-tagged

Cat.No. : AKR1B1-1172HFL
Product Overview : Recombinant Full Length Human AKR1B1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 35.7 kDa
AA Sequence : MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKR EELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILD TWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAY SPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFE
LSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Pyruvate metabolism
Full Length : Full L.
Gene Name AKR1B1 aldo-keto reductase family 1 member B [ Homo sapiens (human) ]
Official Symbol AKR1B1
Synonyms AR; ADR; ALR2; ALDR1
Gene ID 231
mRNA Refseq NM_001628.4
Protein Refseq NP_001619.1
MIM 103880
UniProt ID P15121

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AKR1B1 Products

Required fields are marked with *

My Review for All AKR1B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon