Recombinant Full Length Human AFP Protein, C-Flag-tagged
Cat.No. : | AFP-488HFL |
Product Overview : | Recombinant Full Length Human AFP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatocarcinoma and with teratoma, and has prognostic value for managing advanced gastric cancer. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.3 kDa |
AA Sequence : | MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDA LTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQ VPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVT KELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQD GEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIF LASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEM TPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQK PQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | AFP alpha fetoprotein [ Homo sapiens (human) ] |
Official Symbol | AFP |
Synonyms | AFPD; FETA; HPAFP |
Gene ID | 174 |
mRNA Refseq | NM_001134.3 |
Protein Refseq | NP_001125.1 |
MIM | 104150 |
UniProt ID | P02771 |
◆ Recombinant Proteins | ||
AFP-4180H | Purified Human Alpha-Fetoprotein | +Inquiry |
Afp-2491M | Recombinant Mouse Afp protein, N/A-tagged | +Inquiry |
AFP-289H | Recombinant Human AFP Protein, His (Fc)-Avi-tagged | +Inquiry |
AFP-4769H | Human Alpha-Fetoprotein | +Inquiry |
AFP-118C | Recombinant Cattle AFP Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-3017H | Native Human fetal cord serum | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
AFP-412H | Native Human AFP Protein | +Inquiry |
AFP-3018P | Native pig AFP | +Inquiry |
AFP-1180H | Native Human Alpha-Fetoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AFP-1706HCL | Recombinant Human AFP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFP Products
Required fields are marked with *
My Review for All AFP Products
Required fields are marked with *
0
Inquiry Basket