Recombinant Full Length Human AFMID Protein, C-Flag-tagged

• Cat.No.: AFMID-1534HFL
• Product Overview: Recombinant Full Length Human AFMID Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable hydrolase activity. Predicted to be involved in tryptophan catabolic process to kynurenine. Predicted to be located in cytosol and nucleus. Predicted to be active in cytoplasm.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 33.8 kDa
• AA Sequence: MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD GEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVVIVAYGIAPKGTLDHMVDQ VTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTKHGVTPNLRGFFLVSGVFDLEPIVYTSQNVA LQLTLEDAQRNSPQLKVAQAQPVDPTCRVLVVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHF EIVENLTQKDNVLTQIILKTIFQ myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Tryptophan metabolism
• Full Length: Full L.

Gene Information

• Gene Name: AFMID arylformamidase [ Homo sapiens (human) ]
• Official Symbol: AFMID
• Synonyms: KF; FKF; KFA
• Gene ID: 125061
• mRNA Refseq: NM_001010982.5
• Protein Refseq: NP_001010982.2
• UniProt ID: Q63HM1