Recombinant Full Length Human ACVR1 Protein, C-Flag-tagged
Cat.No. : | ACVR1-1452HFL |
Product Overview : | Recombinant Full Length Human ACVR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55 kDa |
AA Sequence : | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLAC LLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITL LECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLW LITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQC CIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALR IKKTLTKIDNSLDKLKTDCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | ACVR1 activin A receptor type 1 [ Homo sapiens (human) ] |
Official Symbol | ACVR1 |
Synonyms | FOP; ALK2; SKR1; TSRI; ACTRI; ACVR1A; ACVRLK2 |
Gene ID | 90 |
mRNA Refseq | NM_001105.5 |
Protein Refseq | NP_001096.1 |
MIM | 102576 |
UniProt ID | Q04771 |
◆ Recombinant Proteins | ||
ACVR1-489H | Recombinant Human Activin A Receptor, Type I, Fc Chimera | +Inquiry |
ACVR1-300C | Recombinant Canine ACVR1, His tagged | +Inquiry |
ACVR1-5681H | Recombinant Human ACVR1 protein, His & GST-tagged | +Inquiry |
Acvr1-775M | Active Recombinant Mouse Acvr1 protein(Met1-Glu123), His&hFc-tagged | +Inquiry |
ACVR1-201H | Active Recombinant Human ACVR1(R206H), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-2686MCL | Recombinant Mouse ACVR1 cell lysate | +Inquiry |
ACVR1-967CCL | Recombinant Canine ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *
0
Inquiry Basket