Recombinant Full Length Human ACSS2 Protein, C-Flag-tagged
Cat.No. : | ACSS2-84HFL |
Product Overview : | Recombinant Full Length Human ACSS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytosolic enzyme that catalyzes the activation of acetate for use in lipid synthesis and energy generation. The protein acts as a monomer and produces acetyl-CoA from acetate in a reaction that requires ATP. Expression of this gene is regulated by sterol regulatory element-binding proteins, transcription factors that activate genes required for the synthesis of cholesterol and unsaturated fatty acids. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 78.4 kDa |
AA Sequence : | MGLPEERVRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFY WKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQ LLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSL LITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQIS WNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAE DVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFG DEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSAT FPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDG YYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFFTLCDGHTFSPKLTEE LKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSHRCLTI QTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | ACSS2 acyl-CoA synthetase short chain family member 2 [ Homo sapiens (human) ] |
Official Symbol | ACSS2 |
Synonyms | ACS; ACSA; ACAS2; ACECS; AceCS1; dJ1161H23.1 |
Gene ID | 55902 |
mRNA Refseq | NM_018677.4 |
Protein Refseq | NP_061147.1 |
MIM | 605832 |
UniProt ID | Q9NR19 |
◆ Recombinant Proteins | ||
ACSS2-219R | Recombinant Rhesus monkey ACSS2 Protein, His-tagged | +Inquiry |
ACSS2-1107M | Recombinant Mouse ACSS2 Protein, His-tagged | +Inquiry |
ACSS2-814HF | Recombinant Full Length Human ACSS2 Protein, GST-tagged | +Inquiry |
C9orf72-2232H | Recombinant Human C9orf72 protein, His-tagged | +Inquiry |
ACSS2-4019H | Recombinant Human ACSS2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSS2-9068HCL | Recombinant Human ACSS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSS2 Products
Required fields are marked with *
My Review for All ACSS2 Products
Required fields are marked with *
0
Inquiry Basket