Recombinant Full Length Human ABRACL Protein, GST-tagged

• Cat.No.: ABRACL-2683HF
• Product Overview: Human ABRACL full-length ORF (AAH14953, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ABRACL (ABRA C-Terminal Like) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 34.65 kDa
• Protein length: 81 amino acids
• AA Sequence: MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABRACL ABRA C-terminal like [ Homo sapiens (human) ]
• Official Symbol: ABRACL
• Synonyms: ABRACL; ABRA C-terminal like; C6ORF115; chromosome 6 open reading frame 115; C6orf115, chromosome 6 open reading frame 115; Costars; HSPC280; PRO2013; costars family protein ABRACL; ABRA C-terminal-like protein
• Gene ID: 58527
• mRNA Refseq: NM_021243
• Protein Refseq: NP_067066
• UniProt ID: Q9P1F3