Recombinant Full Length Heterosigma Akashiwo Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL32859HF |
Product Overview : | Recombinant Full Length Heterosigma akashiwo Cytochrome c biogenesis protein ccs1(ccs1) Protein (B2XTT2) (1-426aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Heterosigma akashiwo |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-426) |
Form : | Lyophilized powder |
AA Sequence : | MEKIFKILANLKFAIALLLLISITITFGSIIEQDQTLDYYKQNYPLTNPIGGFLTWKVIN MFQLNHIYKNFWFISLLLSLGISLIACTFFQQFPGIKFSRRCYFSNNPRKTDFQTQLKTN LSRNIIYTIISEGYFVFQQKKNFYGTKGIIGRIAPVFVHLSIILILLGSIFASLGGFNSQ ELIGKGEIFHIQNVTSSGPLTKLSQQAIRVNDFWINYYPNNKIKQFYSNLSIINGDGQEV RSKTISVNKPLIYKDLTFYQTDWNLLGLRISHNNKNFQIPVIQTTQNLNKVWLTWLPLES NTSKNLSGETIIINNYKGTIYIYDNNGQLNKKIELSNFIENKNYKLIEFLSVTGIQIKSD PGILFIYFGFGFLMVSTILSYLSFSQVWLGIDYLEQNNIKLTVNAKTNRTKVLLTTQMYK ITKNKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; Heak452_Cp117; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | B2XTT2 |
◆ Recombinant Proteins | ||
PTPN18-3132H | Recombinant Human PTPN18 Protein, MYC/DDK-tagged | +Inquiry |
PARP8-4630Z | Recombinant Zebrafish PARP8 | +Inquiry |
SH-RS13100-6131S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS13100 protein, His-tagged | +Inquiry |
ZC3HAV1-2150C | Recombinant Chicken ZC3HAV1 | +Inquiry |
ACSL4-3160HFL | Recombinant Full Length Human ACSL4 protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
FG-163B | Native Bovine fibrinogen | +Inquiry |
Testosterone-01H | Native Human Testosterone | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
IgG-018R | Native Rabbit Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1746M | Active Native Maackia Amurensis Lectin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHL41-352HCL | Recombinant Human KLHL41 lysate | +Inquiry |
PDZD3-3314HCL | Recombinant Human PDZD3 293 Cell Lysate | +Inquiry |
PPDPF-2981HCL | Recombinant Human PPDPF 293 Cell Lysate | +Inquiry |
SERPINB6B-501MCL | Recombinant Mouse SERPINB6B cell lysate | +Inquiry |
KRTAP13-2-4851HCL | Recombinant Human KRTAP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket