Recombinant Full Length Hepatitis C Virus Genome Polyprotein Protein, His-Tagged
Cat.No. : | RFL18466HF |
Product Overview : | Recombinant Full Length Hepatitis C virus Genome polyprotein Protein (P27959) (384-513aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HCV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (384-513) |
Form : | Lyophilized powder |
AA Sequence : | TTHVTGGATGHTTSGIASLFLPGASQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFY THKFNASGCPERLASCRSIDGFDQGWGPITYTEPGDSDQKPYCWHYAPQRCSVVSAADVC GPVYCFTPSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hepatitis C virus Genome polyprotein |
Synonyms | Genome polyprotein; Fragment |
UniProt ID | P27959 |
◆ Native Proteins | ||
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCN-1323HCL | Recombinant Human SYCN 293 Cell Lysate | +Inquiry |
LYZ-4580HCL | Recombinant Human LYZ 293 Cell Lysate | +Inquiry |
AKT3-728HCL | Recombinant Human AKT3 cell lysate | +Inquiry |
FAM206A-7927HCL | Recombinant Human C9orf6 293 Cell Lysate | +Inquiry |
RPL18-2220HCL | Recombinant Human RPL18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hepatitis C virus Genome polyprotein Products
Required fields are marked with *
My Review for All Hepatitis C virus Genome polyprotein Products
Required fields are marked with *
0
Inquiry Basket