Recombinant Full Length Helicobacter Pylori Uncharacterized Mscs Family Protein Hp_0415 (Hp_0415) Protein, His-Tagged
Cat.No. : | RFL10187HF |
Product Overview : | Recombinant Full Length Helicobacter pylori Uncharacterized MscS family protein HP_0415 (HP_0415) Protein (O25170) (1-623aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-623) |
Form : | Lyophilized powder |
AA Sequence : | MRLLLWWVLVLSLFLNPLRAVEEHETDAVDLFLIFNQINQLNQVIETYKKNPERSAEISL YNTQKNDLIKSLTSKVLNERDKIGIDINQNLKEQEKIKKRLSKSINGDDFYTFMKDRLSL DILLIDEILYRFIDKIRSSIDIFSEQKDVESISDAFLLRLGQFKLYTFPKNLGNVKMHEL EQMFSDYELRLNTYTEVLRYIKNHPKEVLPKNLIMEVNMDFVLNKISKVLPFTTHSLQVS KIVLALTILALLLGLRKLITWLLALLLDRIFEIMQRNKKMHVNVQKSIVSPVSVFLALFS CDVALDIFYYPNASPPKVSMWVGAVYIMLLAWLVIALFKGYGEALVTNMATKSTHNFRKE VINLILKVVYFLIFIVALLGVLKQLGFNVSAIIASLGIGGLAVALAVKDVLANFFASVIL LLDNSFSQGDWIVCGEVEGTVVEMGLRRTTIRAFDNALLSVPNSELAGKPIRNWSRRKVG RRIKMEIGLTYSSSQSALQLCVKDIKEMLENHPKIANGADSALQNVSDYRYMFKKDIVSI DDFLGYKNNLFVFLDQFADSSINILVYCFSKTVVWEEWLEVKEDVMLKIMGIVEKHHLSF AFPSQSLYVESLPEVSLKEGAKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HP_0415 |
Synonyms | HP_0415; Uncharacterized MscS family protein HP_0415 |
UniProt ID | O25170 |
◆ Recombinant Proteins | ||
IGF2-609H | Recombinant Human Insulin-like Growth Factor 2 (somatomedin A) | +Inquiry |
RFL23288SF | Recombinant Full Length Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
UGT2A2-17813M | Recombinant Mouse UGT2A2 Protein | +Inquiry |
JAM3-497H | Recombinant Human JAM3 Protein | +Inquiry |
MED6-557H | Recombinant Human MED6 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
E2-01H | Native Human Estradiol (E2) | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
C3b-06M | Native Mouse C3b Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIPC2-5927HCL | Recombinant Human GIPC2 293 Cell Lysate | +Inquiry |
DSCR3-6810HCL | Recombinant Human DSCR3 293 Cell Lysate | +Inquiry |
HTR6-5331HCL | Recombinant Human HTR6 293 Cell Lysate | +Inquiry |
CD86-1971RCL | Recombinant Rat CD86 cell lysate | +Inquiry |
VPS36-388HCL | Recombinant Human VPS36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HP_0415 Products
Required fields are marked with *
My Review for All HP_0415 Products
Required fields are marked with *
0
Inquiry Basket