Recombinant Full Length Halorhodospira Halophila Upf0761 Membrane Protein Hhal_0704 (Hhal_0704) Protein, His-Tagged
Cat.No. : | RFL2673HF |
Product Overview : | Recombinant Full Length Halorhodospira halophila UPF0761 membrane protein Hhal_0704 (Hhal_0704) Protein (A1WUX4) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Halorhodospira halophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MHYQLRRRGTKMTELRGRLRAAGDRLRALPTHPGVGEARGFGEYLIQRIQQDQCAKSAGM LAYVTLLAIVPLMTIGFSVLAAFPVFEGVTDRLREAMVDYLVPAASDAIDEHLENFMGRA AELTAVGIAGLTVTALLLLNTIERVLNEIWRVERPRPTLQRFMVYWTVLTMGPLLLGVSV ASTSYMGTVNLGPLEPPSDLIAQLLNLAPFVVQAIVFSLIYSLVPHRSVPVLHAVIGGVV ASGLFELAKGGFAAFIARAPTYEVVYGALAALPIFLVWLYISWLVILIGAEVTQALRGYR WRTGGDLARNRWALVLAVHILGHLYQAQRRGAGVTFAELLEQEPDAGEPALAEALETLRR HHVIERSADGAWLLARDTSTFTLAELHRMLAYPLPPAAGLETGAPWDRRLAERLRRVEER WEQSFDLSLSDLLEPTAEEAGAGRSARAEVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hhal_0704 |
Synonyms | Hhal_0704; UPF0761 membrane protein Hhal_0704 |
UniProt ID | A1WUX4 |
◆ Native Proteins | ||
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMPR-5877HCL | Recombinant Human GMPR 293 Cell Lysate | +Inquiry |
F2-2124MCL | Recombinant Mouse F2 cell lysate | +Inquiry |
HSF4-821HCL | Recombinant Human HSF4 cell lysate | +Inquiry |
N6AMT1-3996HCL | Recombinant Human N6AMT1 293 Cell Lysate | +Inquiry |
ARF1-8761HCL | Recombinant Human ARF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hhal_0704 Products
Required fields are marked with *
My Review for All Hhal_0704 Products
Required fields are marked with *
0
Inquiry Basket