Recombinant Full Length Haemophilus Somnus Upf0283 Membrane Protein Hsm_0945 (Hsm_0945) Protein, His-Tagged
Cat.No. : | RFL3486HF |
Product Overview : | Recombinant Full Length Haemophilus somnus UPF0283 membrane protein HSM_0945 (HSM_0945) Protein (B0UT28) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Histophilus somni |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MPKKVFQQEDVEQKITENFEPKQEFEQDELDIEMDCSQFETTMDRQNTDIPFQHMVRPKV TMWQKLLMATICLFSCGILAQSVQWLVDSWRDNQWIAFVFAMVSLFLVLLGLGTIIKEWR RLVQLKKRLILQEKSREIRSKSAVNLTEVSSEGKELCLKIASLMGIDDKSPQLIAWQEQV HEAYTEQEILRLFSQNVLIPFDRVAKKLISKNAVESALIVAVSPLAIVDMFFIAWRNIRL INQLAKLYGIELGYVSRLRLLRMVFVNMAFAGAAEVIQDLGLEWLSQDITAKLSARVAQG IGVGILTARLGIKAMEFCRPIAVAPEEKLRLSHIQTELLGTLKTTLFSANKVKEKVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HSM_0945 |
Synonyms | HSM_0945; UPF0283 membrane protein HSM_0945 |
UniProt ID | B0UT28 |
◆ Recombinant Proteins | ||
ABHD12-4493Z | Recombinant Zebrafish ABHD12 | +Inquiry |
RFL2444BF | Recombinant Full Length Bdellovibrio Bacteriovorus Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
COL6A2-3746M | Recombinant Mouse COL6A2 Protein | +Inquiry |
SGR-RS08865-647S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS08865 protein, His-tagged | +Inquiry |
ALDH2-620R | Recombinant Rat ALDH2 Protein | +Inquiry |
◆ Native Proteins | ||
PALB-134P | Native Pigeon Prealbumin | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
PMSG-01M | Native Pregnant Mare Serum Gonadotropin, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETFB-6531HCL | Recombinant Human ETFB 293 Cell Lysate | +Inquiry |
GRHPR-5749HCL | Recombinant Human GRHPR 293 Cell Lysate | +Inquiry |
HRK-5391HCL | Recombinant Human HRK 293 Cell Lysate | +Inquiry |
Fetal Ovary -151H | Human Fetal Ovary Cytoplasmic Lysate | +Inquiry |
RNF25-1526HCL | Recombinant Human RNF25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HSM_0945 Products
Required fields are marked with *
My Review for All HSM_0945 Products
Required fields are marked with *
0
Inquiry Basket