Recombinant Full Length Haemophilus Influenzae Uncharacterized Protein Hi_0275 (Hi_0275) Protein, His-Tagged
Cat.No. : | RFL14857HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized protein HI_0275 (HI_0275) Protein (P43975) (1-551aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-551) |
Form : | Lyophilized powder |
AA Sequence : | MIAYIFLALFTIAAVIFIVNSHYRWTYFFAITLFTFLFGGMLMVSSQWQRALNFSSVLFV VLMLFHRLKIHYYKQPLLISDFFLVVDWRNWETLIHYKGALFGVIGLLALLGYAIFGFND VESLGVLGNSIGALLFIVSFSLMWHYSKNPSAVQVWLDSLPDDGRDVFLNLPMSCRGIFF KVPNFDGNSQNFIEKMTALSSDANNLSETKPDIVVTLMESTLNPHQFAFSQQSIPPLSMF EPQNDTVFASPLRVHTFAGATWKSEFAFLAGVPSTDFGALASGVFYSVVPHLQSGLVKNL KAQGYFCVALSPFTKGNYNAKSAYDHFGFDLMLQPQDLGYPAPISKNLWDISSEEMMKYT RMILEKQHPALENVDQPMFVYVLTMREHGPYELGMENTFNLQMPNLGAKSISALNDYTQR IVALNDAIEGINNYLHERKKPFVLGYFGDHQVAFDNAIPPKKGDYAQPDYVTQFVVRSNC ASQFKQEQKFLDLAFAGGVLMNVAGLSAEDEFMKANMAMCKLSDGKLEDSSDIQLLNNYR HYLYQTLAIAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_0275 |
Synonyms | HI_0275; Uncharacterized protein HI_0275 |
UniProt ID | P43975 |
◆ Recombinant Proteins | ||
PC-1613H | Recombinant Human PC Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC15A2-3667Z | Recombinant Zebrafish SLC15A2 | +Inquiry |
SLC10A7-873Z | Recombinant Zebrafish SLC10A7 | +Inquiry |
NFKB1-5022H | Recombinant Human NFKB1 protein | +Inquiry |
CD276-1235CAF488 | Recombinant Monkey CD276 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
F2-303R | Native Rat Thrombin | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
Testis-022H | Human Testis Lysate, Total Protein | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAE1-3984HCL | Recombinant Human NAE1 293 Cell Lysate | +Inquiry |
UGT1A4-512HCL | Recombinant Human UGT1A4 293 Cell Lysate | +Inquiry |
Duodenum-524D | Dog Duodenum Lysate, Total Protein | +Inquiry |
PCDHA4-1296HCL | Recombinant Human PCDHA4 cell lysate | +Inquiry |
POFUT1-3057HCL | Recombinant Human POFUT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HI_0275 Products
Required fields are marked with *
My Review for All HI_0275 Products
Required fields are marked with *
0
Inquiry Basket