Recombinant Full Length Haemophilus Influenzae Uncharacterized Protein Hi_0219 (Hi_0219) Protein, His-Tagged
Cat.No. : | RFL15014HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized protein HI_0219 (HI_0219) Protein (P44577) (1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-213) |
Form : | Lyophilized powder |
AA Sequence : | MEIYMSVFNTFVEFVARIVAPMQRQFINFIRIAIFIVMAWIGGLKVCQYEADGIAHFVSN SPFFSYMYEKGPNLVPNDKGELVMEYTLHKNPEGKMVAKNIEWHKENGTYTASYIIGAII VTVGILTLAGIWNATAGLAGGLLTFGMSIVTLSFLITTPEAWVPNLGGDLPTPAYGFPYL SGVGRLVIKDIIMMAGGLTAAAECANRILARKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_0219 |
Synonyms | HI_0219; Uncharacterized protein HI_0219 |
UniProt ID | P44577 |
◆ Native Proteins | ||
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
Lysostaphin-91S | Active Native Staphylococcus staphylolyticus Lysostaphin | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HS3ST1-5387HCL | Recombinant Human HS3ST1 293 Cell Lysate | +Inquiry |
MYL2-4028HCL | Recombinant Human MYL2 293 Cell Lysate | +Inquiry |
ENPP1-6595HCL | Recombinant Human ENPP1 293 Cell Lysate | +Inquiry |
APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
CAMK2G-7876HCL | Recombinant Human CAMK2G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HI_0219 Products
Required fields are marked with *
My Review for All HI_0219 Products
Required fields are marked with *
0
Inquiry Basket