Recombinant Full Length Haemophilus Influenzae Sensor Protein Qsec(Qsec) Protein, His-Tagged
Cat.No. : | RFL4253HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Sensor protein qseC(qseC) Protein (P45336) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MKNRSLTLRLISVLCLTALFVWLGSTLVAWWQVRHDVNKVFDAQQVLFAERLANSDLSTI LLESSTTLNKNSQSVLKKSYDDDALAFAIFSKTGKLLFSDGRNGKDFIFNYKTGFYNANI YDDDDKWRIFWRMAANGELVIAVGQELDYREDLIEEMILGQMWIWFASLPILIIVLGWLI HKELRPIKRLSQEVQTRKSGDVSLLNTEGLPVEILPLVKNLNQFFDRTSAMLQRERRFTS DAAHELRSPLAALRIQIEVAQLAGDDVALREQALLHLTQGIDRASQLIEQLLTLSRLDNL QALETLQLLDWEAIVQSLISERYFVAEKRKITLVFEKESEPKQKQGQSILVSLMLRNLLD NAIKYCPEDTIVSVKISSSQIIIEDNGGGVEPEDLKKLGQRFYRPAGQNEKGSGLGLSIV MRIAELHGFKVRLENVVKEGRRIGLKAIISL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qseC |
Synonyms | qseC; HI_1707; Sensor protein QseC |
UniProt ID | P45336 |
◆ Recombinant Proteins | ||
RFL10305RF | Recombinant Full Length Rat Mas-Related G-Protein Coupled Receptor Member D(Mrgprd) Protein, His-Tagged | +Inquiry |
TMEM50A-4643R | Recombinant Rhesus Macaque TMEM50A Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM5-194H | Recombinant Human CEACAM5 Protein, His\Avi-tagged | +Inquiry |
PLSCR3-4195R | Recombinant Rat PLSCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPBWR1-3076R | Recombinant Rhesus monkey NPBWR1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
F10-5392M | Active Native Mouse Coagulation Factor X | +Inquiry |
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
ACTN1-162C | Native chicken ACTN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPAR1-4675HCL | Recombinant Human LPAR1 293 Cell Lysate | +Inquiry |
VDR-462HCL | Recombinant Human VDR cell lysate | +Inquiry |
TMEM174-987HCL | Recombinant Human TMEM174 293 Cell Lysate | +Inquiry |
RASGRP2-2505HCL | Recombinant Human RASGRP2 293 Cell Lysate | +Inquiry |
UST-450HCL | Recombinant Human UST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All qseC Products
Required fields are marked with *
My Review for All qseC Products
Required fields are marked with *
0
Inquiry Basket