Recombinant Full Length Haemophilus Influenzae Putative L,D-Transpeptidase Hi_1667 (Hi_1667) Protein, His-Tagged
Cat.No. : | RFL30361HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Putative L,D-transpeptidase HI_1667 (HI_1667) Protein (P44285) (1-489aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-489) |
Form : | Lyophilized powder |
AA Sequence : | MVVFKSTLKLSLFALSLSMMMSGCVLVGLSKNDQSKSLYGINLSHLSLAERKELEEAIYA DQQRLTEEKQTLLNMTLTHEIGDHKLQFKPLLARLYASRKYAPLWTDNAAARQLLRDYAA MVASGISKSSATSLETLALVEQQGGLVYDVLLSDILLDYLYYTQNVRSQASNWLYSSAQY QAQQPENDHIQRWLSAVENNQLLDFIQSLAGENHLYRQTIQSLPMFIPTSKESNITQKLA MNAQRLRVIPDFHNGIFVNIPSYKLQYYRDGDLILESRVIVGTNSRRTPVMYSKLSNVVV NPPWNAPIRLINEDLLPKMKADPNYITEHNYSILDNQGNVVDPASIDWESIDNKFPYRVR QAAGDSALGNYKFNMPSSDAIYLHDTPNRGLFNRKNRALSSGCVRVEKSDQLASILLKEA GWTETRKNTVLASKKTTSAPIRSDNPVFLYYVTAWIENGNIVNLPDIYGYDRQINLAEIN WDLVKKYLQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_1667 |
Synonyms | HI_1667; Putative L,D-transpeptidase HI_1667 |
UniProt ID | P44285 |
◆ Native Proteins | ||
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
TTR-31108TH | Native Human TTR | +Inquiry |
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
Lectin-1728L | Active Native Lycopersicon Esculentum Lectin Protein, Texas Red conjugated | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VMP1-1794HCL | Recombinant Human VMP1 cell lysate | +Inquiry |
IQCE-5178HCL | Recombinant Human IQCE 293 Cell Lysate | +Inquiry |
PRSS30P-1106HCL | Recombinant Human PRSS30P cell lysate | +Inquiry |
BMPR1B-1166HCL | Recombinant Human BMPR1B cell lysate | +Inquiry |
SLCO1A2-1690HCL | Recombinant Human SLCO1A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HI_1667 Products
Required fields are marked with *
My Review for All HI_1667 Products
Required fields are marked with *
0
Inquiry Basket