Recombinant Full Length Haemophilus Influenzae Protein Transport Protein Hofc Homolog(Hofc) Protein, His-Tagged
Cat.No. : | RFL22089HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Protein transport protein HofC homolog(hofC) Protein (P44621) (1-406aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-406) |
Form : | Lyophilized powder |
AA Sequence : | MTKKLFYYQASNPLNQKQKGSIIADTKQQAHFQLISRGLTHIKLQQNWQFGAKPKNSEIS ELLNQLATLLQSAIPLKNSLQILQQNCTQIVLNEWLERLLQSIESGLAFSQAIEQQGKYL TQQEIQLIQVGEMTGKLAVVCKKIATHRSQSLALQRKLQKIMLYPSMVLGISLLLTLALL LFIVPQFAEMYSGNNAELPTITAILLSISNFLKQNIGILLFFVLSFFLFYYFYLKRQTWF YQKKNQLISITPIFGTIQKLSRLVNFSQSLQIMLQAGVPLNQALDSFLPRTQTWQTKKTL VNDIVLDKEVRSILQWVSQGYAFSNSVSSDLFPMEAQQMLQIGEQSGKLALMLEHIAENY QEKLNHQIDLLSQMLEPLMMVIIGSLIGIIMMGMYLPIFNMGSVIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hofC |
Synonyms | hofC; hopC; HI_0297; Protein transport protein HofC homolog |
UniProt ID | P44621 |
◆ Recombinant Proteins | ||
GFI1-2166R | Recombinant Rat GFI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB41-12544Z | Recombinant Zebrafish RAB41 | +Inquiry |
KRAS-0959H | Recombinant Human KRAS Protein (T2-K169), GST tagged | +Inquiry |
CLCA1-714R | Recombinant Rhesus Macaque CLCA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLIPR-526H | Recombinant Human GLIPR Protein (22-232 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
IgD-213H | Native Human Immunoglobulin D (IgD) | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
Lectin-1717U | Native Ulex europaeus Lectin | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEF2C-4375HCL | Recombinant Human MEF2C 293 Cell Lysate | +Inquiry |
DPEP2-1177HCL | Recombinant Human DPEP2 cell lysate | +Inquiry |
TNFAIP1-694HCL | Recombinant Human TNFAIP1 lysate | +Inquiry |
SNAP25-1640HCL | Recombinant Human SNAP25 293 Cell Lysate | +Inquiry |
Cerebellum-67H | Human Cerebellum (RT) Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hofC Products
Required fields are marked with *
My Review for All hofC Products
Required fields are marked with *
0
Inquiry Basket