Recombinant Full Length Haemophilus Ducreyi Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL4509HF |
Product Overview : | Recombinant Full Length Haemophilus ducreyi Membrane protein insertase YidC(yidC) Protein (Q7VPM2) (1-536aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus ducreyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-536) |
Form : | Lyophilized powder |
AA Sequence : | MNSNRSLLVMGLLLVSFLIFTQWQQDFNPEIQAQKQAQQQSRDVPHATNTANAITEHMTK GKTITVESDVLRLVIDTLGGDVIESDLLAHKASLDSTDPLKLLTTEGLIYTAQSGLVGKN GIDTHIGRAPYQVTQDHFTLAKGQNEIVVPMTFEQDGVMYTKTFTLKRGSYDVAVSFDIQ NNSANTIEVQPYGQIKHSLLDSSGNLAMPTYTGGAYSSSETNYKKYSFDEMTKANLNIDT KGGWVALLQHYFVSAWVPNQDASNTLYSRTHNGVATIGYRGPITTVKPNTKTTITSQLWT GPKDQKEMAQAATHLELTVDYGWAWFIAKPLFWLLIFIHSIIGNWGLAIMGVTLVVKSLL YPLTKAQYTSMAKMRMLQPKLQELRERYGDDRQQMSQEMMKLYKQEKVNPMGGCLPLILQ MPIFIALYWTFMEAVELRHAPFFGWIQDLSAQDPYYIFPVLMGLSMFLLQKMSPTAVADP TQLKVMTFMPVIFTVFFLWFPSGLVLYWLTSNCITIVQQWLIYRNLEKKGLHTRKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; HD_0040; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q7VPM2 |
◆ Recombinant Proteins | ||
C2CD2L-5493C | Recombinant Chicken C2CD2L | +Inquiry |
SH-RS03890-5645S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS03890 protein, His-tagged | +Inquiry |
STAT5B-6343C | Recombinant Chicken STAT5B | +Inquiry |
FGF4-413F | Active Recombinant Human FGF4 Protein (177 aa) | +Inquiry |
SLC30A8-15379M | Recombinant Mouse SLC30A8/ZNT8 Protein | +Inquiry |
◆ Native Proteins | ||
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
F10-9H | Native Human Factor Xa, Active Site Labeled with Biotin | +Inquiry |
ADVag-281V | Active Native ADV Protein | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELSPBP1-6614HCL | Recombinant Human ELSPBP1 293 Cell Lysate | +Inquiry |
ZNF302-97HCL | Recombinant Human ZNF302 293 Cell Lysate | +Inquiry |
EBF4-1537HCL | Recombinant Human EBF4 cell lysate | +Inquiry |
G6PC2-6081HCL | Recombinant Human G6PC2 293 Cell Lysate | +Inquiry |
ADORA1-9006HCL | Recombinant Human ADORA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket