Recombinant Full Length Guinea Pig Potassium Voltage-Gated Channel Subfamily H Member 2(Kcnh2) Protein, His-Tagged
Cat.No. : | RFL1218CF |
Product Overview : | Recombinant Full Length Guinea pig Potassium voltage-gated channel subfamily H member 2(KCNH2) Protein (O08703) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-162) |
Form : | Lyophilized powder |
AA Sequence : | AVWDWLILLLVIYTAVFTPYSAAFLLKEPEEDAQTADCGYACQPLAVVDLIVDIMFIVDI LINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTA RLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNH2 |
Synonyms | KCNH2; ERG; Potassium voltage-gated channel subfamily H member 2; Ether-a-go-go-related gene potassium channel 1; ERG-1; Eag-related protein 1; Ether-a-go-go-related protein 1; gp-erg; Voltage-gated potassium channel subunit Kv11.1; Fragment |
UniProt ID | O08703 |
◆ Cell & Tissue Lysates | ||
KCNH2-5059HCL | Recombinant Human KCNH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNH2 Products
Required fields are marked with *
My Review for All KCNH2 Products
Required fields are marked with *
0
Inquiry Basket