Recombinant Full Length Guinea Pig Alpha-2C Adrenergic Receptor(Adra2C) Protein, His-Tagged
Cat.No. : | RFL8429CF |
Product Overview : | Recombinant Full Length Guinea pig Alpha-2C adrenergic receptor(ADRA2C) Protein (Q60476) (1-455aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-455) |
Form : | Lyophilized powder |
AA Sequence : | MASPALAAALLAAEGPNASGAGEGGGGVNASGAVWGPPPSQYSAGAVAGLAAVVGFLIVF TVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWC GVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAIISF PPLVSFYRQPDGAAYPRCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTL SEKRGPAGPEGESPTTENGLGAAAAAAAGENGHCAPPRADVEPDESSAAERRRRRGALRR GARQREAGVEAPGPGLGSAAADPGALSVSRSPGPGGRLSRASSRSVEFFLSRRRRARSSV CRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPTPLFKFFFWIGY CNSSLNPVIYTIFNQDFRRSFKHILFRRRRRGFRQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADRA2C |
Synonyms | ADRA2C; Alpha-2C adrenergic receptor; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2CAR |
UniProt ID | Q60476 |
◆ Recombinant Proteins | ||
ADRA2C-199R | Recombinant Rat ADRA2C Protein, His (Fc)-Avi-tagged | +Inquiry |
ADRA2C-364M | Recombinant Mouse ADRA2C Protein, His (Fc)-Avi-tagged | +Inquiry |
ADRA2C-1384M | Recombinant Mouse ADRA2C Protein | +Inquiry |
RFL815DF | Recombinant Full Length Danio Rerio Alpha-2C Adrenergic Receptor(Adra2C) Protein, His-Tagged | +Inquiry |
Adra2c-3334R | Recombinant Rat Adra2c, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADRA2C-8999HCL | Recombinant Human ADRA2C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADRA2C Products
Required fields are marked with *
My Review for All ADRA2C Products
Required fields are marked with *
0
Inquiry Basket