Recombinant Full Length Guinea Pig 5-Hydroxytryptamine Receptor 7(Htr7) Protein, His-Tagged
Cat.No. : | RFL24475CF |
Product Overview : | Recombinant Full Length Guinea pig 5-hydroxytryptamine receptor 7(HTR7) Protein (P50407) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL KLAERPERPECVLQNSDYCRKKGHDS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HTR7 |
Synonyms | HTR7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; 5-HT-X; Serotonin receptor 7 |
UniProt ID | P50407 |
◆ Recombinant Proteins | ||
HTR7-7941M | Recombinant Mouse HTR7 Protein | +Inquiry |
RFL34812XF | Recombinant Full Length Xenopus Laevis 5-Hydroxytryptamine Receptor 7(Htr7) Protein, His-Tagged | +Inquiry |
HTR7-26031TH | Recombinant Human HTR7, T7 -tagged | +Inquiry |
RFL23639RF | Recombinant Full Length Rat 5-Hydroxytryptamine Receptor 7(Htr7) Protein, His-Tagged | +Inquiry |
HTR7-2971R | Recombinant Rat HTR7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR7-5330HCL | Recombinant Human HTR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR7 Products
Required fields are marked with *
My Review for All HTR7 Products
Required fields are marked with *
0
Inquiry Basket