Recombinant Full Length Guillardia Theta Cytochrome C Biogenesis Protein Ccs1(Ccs1) Protein, His-Tagged
Cat.No. : | RFL1001GF |
Product Overview : | Recombinant Full Length Guillardia theta Cytochrome c biogenesis protein ccs1(ccs1) Protein (O78437) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guillardia theta (Cryptomonas phi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MNYIIKFLNKLNNLTVAIIILLAIALASALGTVIEQNKNTDFYLKNYPLTKPLFNFVTSD LILKFGLDHVYTSWWFIFLIILLLLSLTLCTITRQLPALKLARLWQFYTNFNTKAKFQIR FKTNSSSLTKLTYYLEEKNYKIKHFNHFVYAYKGIFGRVSPIIVHFSLVIVLIGSMLSTT QGRTQEAFIVVNQEKPVLDTYEAYVNDFKIAYNSQGLIDQFYSDLILETRQASKIQKTIY VNEPLNYSNITIYQTDWNIDNLVICIDNQNYYSIPLQFIELPNGSESKYWINRLDLFGQS VFCVVNDLTGIVYLYNQNKDLICISSLGEFITLNGHTITFNKLVASTGLQFKLDSFIPLV YLGFLLLMISTLLSYISYSQVWLVKNGSTTYIFGSTNRAKFAFIKQLTEIANQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccs1 |
Synonyms | ccs1; ycf44; Cytochrome c biogenesis protein Ccs1 |
UniProt ID | O78437 |
◆ Recombinant Proteins | ||
JTB-4691M | Recombinant Mouse JTB Protein, His (Fc)-Avi-tagged | +Inquiry |
YULC-1998B | Recombinant Bacillus subtilis YULC protein, His-tagged | +Inquiry |
TGFB1 & GARP-3433C | Recombinant Cynomolgus TGFB1(Leu30-Ser390) & GARP(Ala18-Leu628) Protein, His-Avi-tagged, Biotinylated | +Inquiry |
GRM4-8488Z | Recombinant Zebrafish GRM4 | +Inquiry |
MDM2-2711R | Recombinant Rhesus monkey MDM2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
IgG-007G | Native Goat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
LDH2-20H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPC1-8404HCL | Recombinant Human BRP44L 293 Cell Lysate | +Inquiry |
NADK2-8014HCL | Recombinant Human C5orf33 293 Cell Lysate | +Inquiry |
C1orf115-8185HCL | Recombinant Human C1orf115 293 Cell Lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
PSMD4-2748HCL | Recombinant Human PSMD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccs1 Products
Required fields are marked with *
My Review for All ccs1 Products
Required fields are marked with *
0
Inquiry Basket