Recombinant Full Length Gossypium Hirsutum Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL6422GF |
Product Overview : | Recombinant Full Length Gossypium hirsutum NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q2L952) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gossypium hirsutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIYTTEVEDINSFYTLESLKEVYGIIWMLVPILTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLLFKENILPSRGNTRLFSIGPAIAVISILLSFSVIPFSS RLILADLNIGIFLWIAISSIAPVGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLLSSLFVTVLYLGGWNISIPYVFAPELFEINKINGI IGTTIGIFITLAKTYLFLFISIATRWTLPRLRMDQLLNLGWKFLLPISLGNLLLTTSFQL LSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q2L952 |
◆ Recombinant Proteins | ||
CHRNG-1060R | Recombinant Rat CHRNG Protein, His (Fc)-Avi-tagged | +Inquiry |
TIMM23-5728R | Recombinant Rat TIMM23 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD274-188MA | Recombinant Mouse CD274 protein, MIgG2a Fc-tagged, APC labeled | +Inquiry |
PPP1R16A-7010M | Recombinant Mouse PPP1R16A Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9874EF | Recombinant Full Length Escherichia Coli O9:H4 Upf0056 Inner Membrane Protein Marc(Marc) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
SERPINF2-5338H | Active Native Human SERPINF2 Protein | +Inquiry |
Lectin-1720P | Native Peanut Lectin, Biotin conjugated | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR2-1899MCL | Recombinant Mouse IFNGR2 cell lysate | +Inquiry |
SMURF2-1646HCL | Recombinant Human SMURF2 293 Cell Lysate | +Inquiry |
HLA-DPB1-5505HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
CAP2-7867HCL | Recombinant Human CAP2 293 Cell Lysate | +Inquiry |
MAPKAPK5-432HCL | Recombinant Human MAPKAPK5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket