Recombinant Full Length Gossypium Hirsutum Chloroplast Envelope Membrane Protein(Cema) Protein, His-Tagged
Cat.No. : | RFL1016GF |
Product Overview : | Recombinant Full Length Gossypium hirsutum Chloroplast envelope membrane protein(cemA) Protein (Q2L922) (1-229aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gossypium hirsutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-229) |
Form : | Lyophilized powder |
AA Sequence : | MAKKKAFTPLLYLASIVFLPWWISLSFNKSLKSWITNWWDTRQSETFLNDIQEKSILEQF IEVEELFLLDEMIKEYPETHLQKLRIGIQKETIQLIKLHNEDHIHTILHFSTNLICFVIL SGYSILGNEELLILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFAHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cemA |
Synonyms | cemA; Chloroplast envelope membrane protein |
UniProt ID | Q2L922 |
◆ Recombinant Proteins | ||
SCO3023-421S | Recombinant Streptomyces coelicolor A3(2) SCO3023 protein, His-tagged | +Inquiry |
ALDH1B1-488H | Recombinant Human Aldehyde Dehydrogenase 1 Family, Member B1, GST-tagged | +Inquiry |
ARMT1-243R | Recombinant Rhesus Macaque ARMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDR1-220H | Recombinant Human DDR1 Protein, hIgG-His-tagged | +Inquiry |
Pigr-1474R | Recombinant Rat Pigr protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
Mucin-078P | Native Porcine Mucin Protein | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Ovary -152H | Human Fetal Ovary Lysate | +Inquiry |
CDK17-7632HCL | Recombinant Human CDK17 293 Cell Lysate | +Inquiry |
SPATA17-1540HCL | Recombinant Human SPATA17 293 Cell Lysate | +Inquiry |
ARPC3-37HCL | Recombinant Human ARPC3 lysate | +Inquiry |
PDCD1LG2-1738MCL | Recombinant Mouse PDCD1LG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cemA Products
Required fields are marked with *
My Review for All cemA Products
Required fields are marked with *
0
Inquiry Basket