Recombinant Full Length Gorilla Gorilla Gorilla Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 13(Ndufa13) Protein, His-Tagged

• Cat.No.: RFL28834GF
• Product Overview: Recombinant Full Length Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13) Protein (Q0MQ89) (2-144aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Gorilla gorilla gorilla (Western lowland gorilla)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length of Mature Protein (2-144)
• AA Sequence: GASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQ IEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLI GELYGLRTTEEALHASHGFMWYT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: NDUFA13
• Synonyms: NDUFA13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Complex I-B16.6; CI-B16.6; NADH-ubiquinone oxidoreductase B16.6 subunit
• UniProt ID: Q0MQ89