Recombinant Full Length Glycine Max Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged
Cat.No. : | RFL17492GF |
Product Overview : | Recombinant Full Length Glycine max Photosystem II CP43 chlorophyll apoprotein(psbC) Protein (Q2PMT9) (15-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Glycine max |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (15-473) |
Form : | Lyophilized powder |
AA Sequence : | TLFNGTLALTGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAH FVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHAL LGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGIYDTWAPGGG DVRKITNLTLSPSIIFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILT KPFAWARRALVWSGEAYLSYSLGALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQA FTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNG LDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLG FFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbC |
Synonyms | psbC; Photosystem II CP43 reaction center protein; PSII 43 kDa protein; Protein CP-43 |
UniProt ID | Q2PMT9 |
◆ Recombinant Proteins | ||
H2AFX-2027R | Recombinant Rhesus monkey H2AFX Protein, His-tagged | +Inquiry |
ZHX2-19174M | Recombinant Mouse ZHX2 Protein | +Inquiry |
RFL21288SF | Recombinant Full Length Staphylococcus Aureus Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
PLAT-4154R | Recombinant Rat PLAT Protein, His (Fc)-Avi-tagged | +Inquiry |
REG4-302H | Recombinant Human REG4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
RNase-43B | Active Native Bovine Ribonuclease | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
Lectin-1726W | Native Wheat Germ Lectin, FITC conjugated | +Inquiry |
CKM-5305H | Native Human creatine kinase, muscle | +Inquiry |
Lectin-1782G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES1-5582HCL | Recombinant Human HES1 293 Cell Lysate | +Inquiry |
C12orf49-8317HCL | Recombinant Human C12orf49 293 Cell Lysate | +Inquiry |
RARG-2512HCL | Recombinant Human RARG 293 Cell Lysate | +Inquiry |
MRPL9-4154HCL | Recombinant Human MRPL9 293 Cell Lysate | +Inquiry |
DNAJB1-6892HCL | Recombinant Human DNAJB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbC Products
Required fields are marked with *
My Review for All psbC Products
Required fields are marked with *
0
Inquiry Basket