Recombinant Full Length Glycine Max Nad(P)H-Quinone Oxidoreductase Subunit 1, Chloroplastic(Ndha) Protein, His-Tagged
Cat.No. : | RFL19109GF |
Product Overview : | Recombinant Full Length Glycine max NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) Protein (Q2PMN7) (1-363aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Glycine max |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-363) |
Form : | Lyophilized powder |
AA Sequence : | MIIYLTEIQDIHFFFRLESFKEIYGIIWVFAPILILILGITISVLAIVWLEREISAGIQQ RIGPEYTGPFGVLQALADGTKLLFKENLIPSRGDIRLFSIGPSISVISIIISYSVIPFGY NFVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLGGLRAAAQSISYEIPLTLCVL SISLLSNSLSTVDIVDAQSKYGFWGWNLWRQPMGFIVFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLFISSLFVTVLYFGGSNISIPYIFVSDFFEINQTYGV FVTIIGIFITLAKTYLFLFLSIATRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSSQL FSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhA |
Synonyms | ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1 |
UniProt ID | Q2PMN7 |
◆ Native Proteins | ||
MB-01B | Native Bovine MB Protein | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP4-113HCL | Recombinant Human ARHGAP4 cell lysate | +Inquiry |
TCTE1-1163HCL | Recombinant Human TCTE1 293 Cell Lysate | +Inquiry |
NDEL1-3937HCL | Recombinant Human NDEL1 293 Cell Lysate | +Inquiry |
HepG2-163H | HepG2 Whole Cell Lysate | +Inquiry |
AURKB-8560HCL | Recombinant Human AURKB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhA Products
Required fields are marked with *
My Review for All ndhA Products
Required fields are marked with *
0
Inquiry Basket