Recombinant Full Length Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged
Cat.No. : | RFL23370VF |
Product Overview : | Recombinant Full Length Glycerol-3-phosphate acyltransferase(plsY) Protein (Q87SL3) (1-203aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Parahaemolyticus Serotype O3:K6 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-203) |
Form : | Lyophilized powder |
AA Sequence : | MDALALIMTMAAYLLGSVSSAVLICRLLKLPDPRNVGSNNPGATNVLRIGGKGAAVSVLL CDMLKGTIPVWGGYFLGIDPIILGVIAIAACLGHMYPIFFHFKGGKGVATALGAIAPIGL DLTGLVMLTWLSVAVLFRYSSLAALVTVLVTPFYTWMFKPQYTLPVAMLCCLIVFKHHQN IRRLLSGEEPKIGEKKLTEKNSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | plsY |
Synonyms | plsY; VP0410; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase |
UniProt ID | Q87SL3 |
◆ Recombinant Proteins | ||
TGOLN2-651H | Recombinant Human TGOLN2 Protein, His-tagged | +Inquiry |
CD99-18H | Recombinant Human CD99 protein, His-tagged | +Inquiry |
NR1I3-3094R | Recombinant Rhesus monkey NR1I3 Protein, His-tagged | +Inquiry |
ACOT10-1196M | Recombinant Mouse ACOT10 Protein | +Inquiry |
PTK2B-545H | Recombinant Human PTK2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
ORM1-8017R | Native Rat Serum Alpha-1-Acid GlycoProtein | +Inquiry |
EPX-8107H | Native Human Eosinophil Peroxidase | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1E-7681HCL | Recombinant Human CD1E 293 Cell Lysate | +Inquiry |
RFX3-2398HCL | Recombinant Human RFX3 293 Cell Lysate | +Inquiry |
Salivary-730P | Pig Submaxillary Lysate, Total Protein | +Inquiry |
FGFR1-476HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
HIST1H2BI-5538HCL | Recombinant Human HIST1H2BI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All plsY Products
Required fields are marked with *
My Review for All plsY Products
Required fields are marked with *
0
Inquiry Basket