Recombinant Full Length Gloeobacter Violaceus Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL14754GF |
Product Overview : | Recombinant Full Length Gloeobacter violaceus Lipoprotein signal peptidase(lspA) Protein (Q7NPI3) (1-173aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gloeobacter violaceus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-173) |
Form : | Lyophilized powder |
AA Sequence : | MSAKNPWFWLAAILAIALDRLTKVWVVAQLAPGESIALWPGVFHLTLVKNSGAAFSLFAG GSDWLKWISLLVSVGLCVYALVGPHLGSWEQMGFGLLLGGAVGNGFDRFAFGEVTDFLDF RLIQFPVFNGADIAINLGLACLLIGTLRSESRTPAPARPASKQIREPTDTTGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; glr0072; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | Q7NPI3 |
◆ Recombinant Proteins | ||
CISD2-1379H | Recombinant Human CISD2 Protein, GST-tagged | +Inquiry |
NBPF4-3590H | Recombinant Human NBPF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHA2-1483R | Recombinant Rhesus monkey EPHA2 Protein, His-tagged | +Inquiry |
RFL705SF | Recombinant Full Length Streptomyces Coelicolor Nadh-Quinone Oxidoreductase Subunit K 2(Nuok2) Protein, His-Tagged | +Inquiry |
Cdnf-485M | Recombinant Mouse Cdnf Protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
FSH-35H | Native Human FSH | +Inquiry |
PROZ-5470H | Native Human Protein Z, Vitamin K-Dependent Plasma Glycoprotein | +Inquiry |
CA-50-381H | Active Native Human Cancer Antigen 50 | +Inquiry |
SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHBDD2-2364HCL | Recombinant Human RHBDD2 293 Cell Lysate | +Inquiry |
C19orf59-8199HCL | Recombinant Human C19orf59 293 Cell Lysate | +Inquiry |
PTPRA-503HCL | Recombinant Human PTPRA cell lysate | +Inquiry |
DBP-7062HCL | Recombinant Human DBP 293 Cell Lysate | +Inquiry |
ZBTB32-743HCL | Recombinant Human ZBTB32 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket