Recombinant Full Length Gibberella Zeae Palmitoyltransferase Pfa5(Pfa5) Protein, His-Tagged
Cat.No. : | RFL25301GF |
Product Overview : | Recombinant Full Length Gibberella zeae Palmitoyltransferase PFA5(PFA5) Protein (Q4I1J3) (1-507aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gibberella zeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-507) |
Form : | Lyophilized powder |
AA Sequence : | MTVDVLVARSDELDLASNTSDTTINATVVKDETIITRPPPTLTRSWSLPNASTRRTDNPA PPVLTRASSLPVKLVEPATDIDSDSSSVWTWAWSDEMQGPATSKRCGTRWIARLLPFFML MLVGYATYDVVVYCCVEYFIQEIRKTATAIVLIVFYTIFFILMVAAYIRCYVTIQFNTGF VPWTAAREAAESERNERSTNGGDVESLQWSPADTNPDSPGLEAFYSKDVFICESDGLPKW CSECRSWKPDRAHHSSEYGRCVYKMDHVCPWMGGIISETSFNFFIQFTFYCACYCVLIVS TNAYVVTLRRNAGQSVEGRVVVGLALGSLFGLFSIAMTVTALRFVFQNITNVDLFRKNQT FRLAVRVPTGTRSTDQFTTITYPLSPPGDDSRAPGTAHSNGVDQSDGAGSIATNRMAARD QRAKRTFAILQTQSGENPWHVGYRNNFKSVMGETIFEWFLPLRHSPCTRHDSMVSDYEFG PLVEELKRRYGLAEEDAEKGANETTSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA5 |
Synonyms | PFA5; FGRAMPH1_01T11169; FGRRES_16945_M; FGSG_08915; Palmitoyltransferase PFA5; Protein fatty acyltransferase 5 |
UniProt ID | Q4I1J3 |
◆ Recombinant Proteins | ||
DGAT2-001H | Recombinant Human DGAT2 Protein, GST-tagged | +Inquiry |
RFL35517MF | Recombinant Full Length Mouse Fatty Acid Desaturase 1(Fads1) Protein, His-Tagged | +Inquiry |
SGR-RS29140-649S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS29140 protein, His-tagged | +Inquiry |
IL4-151H | Recombinant Human IL4 Protein, C-Term, Tag Free, Biotinylated | +Inquiry |
FCER2-539H | Recombinant Human FCER2 Protein | +Inquiry |
◆ Native Proteins | ||
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
Immunoglobulin G3-83H | Native Human Immunoglobulin G3 | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
C4B-1846H | Native Human C4B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM80-930HCL | Recombinant Human TMEM80 293 Cell Lysate | +Inquiry |
FYN-6091HCL | Recombinant Human FYN 293 Cell Lysate | +Inquiry |
SLC9A8-1692HCL | Recombinant Human SLC9A8 293 Cell Lysate | +Inquiry |
TECPR1-481HCL | Recombinant Human TECPR1 cell lysate | +Inquiry |
ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA5 Products
Required fields are marked with *
My Review for All PFA5 Products
Required fields are marked with *
0
Inquiry Basket