Recombinant Full Length Getah Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL14370GF |
Product Overview : | Recombinant Full Length Getah virus Structural polyprotein Protein (Q5Y388) (816-1253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Getah virus (GETV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (816-1253) |
Form : | Lyophilized powder |
AA Sequence : | YEHTATIPNVVGFPYKAHIERNGFSPMTLQLEVLGTSLEPTLNLEYITCEYKTVVPSPYI KCCGTSECRSMERPDYQCQVYTGVYPFMWGGAYCFCDTENTQLSEAYVDRSDVCKHDHAA AYKAHTAAMKATIRISYGNLNQTTTAFVNGEHTVTVGGSRFTFGPISTAWTPFDNKIVVY KNDVYNQDFPPYGSGQPGRFGDIQSRTVESKDLYANTALKLSRPSSGTVHVPYTQTPSGF KYWIKERGTSLNDKAPFGCVIKTNPVRAENCAVGNIPVSMDIPDTAFTRVIDAPAVTNLE CQVAVCTHSSDFGGIATLTFKTDKPGKCAVHSHSNVATIQEAAVDIKTDGKITLHFSTAS ASPAFKVSVCSAKTTCMAACEPPKDHIVPYGASHNNQVFPDMSGTAMTWVQRVAGGLGGL TLAAVAVLILVTCVTMRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Getah virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q5Y388 |
◆ Recombinant Proteins | ||
SMARCAD1-2914Z | Recombinant Zebrafish SMARCAD1 | +Inquiry |
CDK13-3193M | Recombinant Mouse CDK13 Protein | +Inquiry |
RFL8636CF | Recombinant Full Length Serpentine Receptor Class R-10(Odr-10) Protein, His-Tagged | +Inquiry |
TNFSF8-2258H | Recombinant Human TNFSF8 Protein, MYC/DDK-tagged | +Inquiry |
RFL6548SF | Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhf2(Mnhf2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
ALB-312B | Native Bovine Albumin Fluorescein | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
MB-237C | Native Dog Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
EHHADH-6686HCL | Recombinant Human EHHADH 293 Cell Lysate | +Inquiry |
PRICKLE1-2871HCL | Recombinant Human PRICKLE1 293 Cell Lysate | +Inquiry |
SNX11-1603HCL | Recombinant Human SNX11 293 Cell Lysate | +Inquiry |
Bone-602R | Rat Bone Marrow Lysate, Total Protein | +Inquiry |
IDH3G-5302HCL | Recombinant Human IDH3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Getah virus Structural polyprotein Products
Required fields are marked with *
My Review for All Getah virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket