Recombinant Full Length Geobacillus Kaustophilus Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged
Cat.No. : | RFL25168GF |
Product Overview : | Recombinant Full Length Geobacillus kaustophilus Lipoprotein signal peptidase(lspA) Protein (Q5L0V0) (1-154aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacillus kaustophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-154) |
Form : | Lyophilized powder |
AA Sequence : | MAYYWIAAAVVILDQWTKWLVVRYMQLGESIPIIDNVLYITSHRNRGAAWGMLEGQFWLF YLITVIVVAAIVIYIRRLKPSERLAGVGLGLMLGGAIGNFLDRVFRKEVVDFIHAYIGTY SFPVFNVADSALTVGVILLFVHMFFFATPEKGNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lspA |
Synonyms | lspA; GK1145; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II |
UniProt ID | Q5L0V0 |
◆ Native Proteins | ||
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
Lectin-1840S | Active Native Sambucus Nigra Lectin Protein, Cy5 labeled | +Inquiry |
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFASC-918HCL | Recombinant Human NFASC cell lysate | +Inquiry |
HIST1H4C-329HCL | Recombinant Human HIST1H4C lysate | +Inquiry |
TBX5-1198HCL | Recombinant Human TBX5 293 Cell Lysate | +Inquiry |
CPSF3-7304HCL | Recombinant Human CPSF3 293 Cell Lysate | +Inquiry |
BCL6B-8478HCL | Recombinant Human BCL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lspA Products
Required fields are marked with *
My Review for All lspA Products
Required fields are marked with *
0
Inquiry Basket