Recombinant Full Length Gazella Dama Cytochrome C Oxidase Subunit 3(Mt-Co3) Protein, His-Tagged
Cat.No. : | RFL35806NF |
Product Overview : | Recombinant Full Length Gazella dama Cytochrome c oxidase subunit 3(MT-CO3) Protein (O48374) (1-261aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Nanger dama (Dama gazelle) (Gazella dama) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-261) |
Form : | Lyophilized powder |
AA Sequence : | MTHQTHAYHMVNPSPWPLTGALSALLMTSGLIMWFHFNSVALLTLGLTTNMLTMYQWWRD VIRESTFQGHHTPNVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTG IHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRNHMLQALFITIALGVYFTLLQASE YYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSSHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-CO3 |
Synonyms | MT-CO3; COIII; COXIII; MTCO3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III |
UniProt ID | O48374 |
◆ Recombinant Proteins | ||
BCKDHB-1763HFL | Recombinant Full Length Human BCKDHB Protein, C-Flag-tagged | +Inquiry |
SIRT7-120H | Recombinant Human SIRT7 Protein, His-tagged | +Inquiry |
RFL36550LF | Recombinant Full Length Listeria Welshimeri Serovar 6B Cardiolipin Synthase(Cls) Protein, His-Tagged | +Inquiry |
Scgb1a1-5183M | Recombinant Mouse Scgb1a1 protein, His-tagged | +Inquiry |
CCDC147-301260H | Recombinant Human CCDC147 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-46H | Native Human MMP-2 | +Inquiry |
LDH-226H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
IgG-7438M | Native Mouse IgG Fc Protein, Biotin conjugated | +Inquiry |
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
Gamma Globulin-72H | Native Human Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYLK4-4014HCL | Recombinant Human MYLK4 293 Cell Lysate | +Inquiry |
PTGR1-2708HCL | Recombinant Human PTGR1 293 Cell Lysate | +Inquiry |
ZNF385A-85HCL | Recombinant Human ZNF385A 293 Cell Lysate | +Inquiry |
LRRC23-4641HCL | Recombinant Human LRRC23 293 Cell Lysate | +Inquiry |
UNC5CL-1887HCL | Recombinant Human UNC5CL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MT-CO3 Products
Required fields are marked with *
My Review for All MT-CO3 Products
Required fields are marked with *
0
Inquiry Basket