Recombinant Full Length Galdieria Sulphuraria Photosystem I Reaction Center Subunit Psak(Psak) Protein, His-Tagged
Cat.No. : | RFL12931GF |
Product Overview : | Recombinant Full Length Galdieria sulphuraria Photosystem I reaction center subunit PsaK(psaK) Protein (P31567) (1-69aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Galdieria sulphuraria (Red alga) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-69) |
Form : | Lyophilized powder |
AA Sequence : | MLIAVSTNIIFIVVNTICVILGKYSVQNKKNESYSIANINLAELLASMSLGHIISSATVL GLKSLNLIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psaK |
Synonyms | psaK; Photosystem I reaction center subunit PsaK; PSI-K; Photosystem I subunit X |
UniProt ID | P31567 |
◆ Recombinant Proteins | ||
DEFB116-1230R | Recombinant Rhesus monkey DEFB116 Protein, His-tagged | +Inquiry |
HIV1Cgp41-104H | Recombinant HIV-1C gp41 Envelope Protein | +Inquiry |
REG4-697H | Recombinant Human REG4 Protein, His-tagged | +Inquiry |
alr2278-2266N | Recombinant Nostoc sp. alr2278 protein, MBP&His-tagged | +Inquiry |
SCO2592-490S | Recombinant Streptomyces coelicolor A3(2) SCO2592 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
calc1-8308S | Native Salmon calc1 | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM208-967HCL | Recombinant Human TMEM208 293 Cell Lysate | +Inquiry |
C12orf50-8315HCL | Recombinant Human C12orf50 293 Cell Lysate | +Inquiry |
ING2-5208HCL | Recombinant Human ING2 293 Cell Lysate | +Inquiry |
LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
HYLS1-5321HCL | Recombinant Human HYLS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psaK Products
Required fields are marked with *
My Review for All psaK Products
Required fields are marked with *
0
Inquiry Basket