Recombinant Full Length Frog Virus 3 Putative Myristoylated Protein 053R(Fv3-053R) Protein, His-Tagged
Cat.No. : | RFL21768FF |
Product Overview : | Recombinant Full Length Frog virus 3 Putative myristoylated protein 053R(FV3-053R) Protein (Q6GZS3) (2-522aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Frog virus 3 (isolate Goorha) (FV-3) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-522) |
Form : | Lyophilized powder |
AA Sequence : | GAAESINTVNIVTKAYAKIMTTMVTDQDITADQSQVFSIDHVKGDVVIKGDVFTQMLVIN LASLMKAIATQSAQDQLIDNIAQQAQAAVSGLNLAQYAYVSNNIDRLITACVQMSTDMRV SCKSKVTMTQSFSVTDVEGDVRVTGVKFNQFANILSSCAMDASVNNDQARDIVSQIKQRG DAKASGLDPTTLIVIIVLVMVGAPMGAGFMAGRRAIGPLLASVGLIGGGAVALGYVPRPV KIEGFSSDPDFTLAQPAATVKGLTFTAAVAKLKSTDGYGALFWKNYDVKGTTAVKLQETL SYFAPAGYDPASWAGVGDSAPPFRIFPGLYQGKGDPGARPRAAYGYAGPVAGPKKGDAYL DGDTGSYYVLGDSWKMRGTISGHQNGRTDYWGTVDPTTTAALTGSERYIWVDPFTLVKST VWLFTGSPKKWTQQQTAPLDIPLTNTPSDFNVWVYKDDTAVQAVKWSSVGAGVAGAALTA SALLMPDSVASSEMSPAVGTGTPAIGTGSPAVGTGFPAHRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FV3-053R |
Synonyms | FV3-053R; Putative myristoylated protein 053R |
UniProt ID | Q6GZS3 |
◆ Recombinant Proteins | ||
POTEG-1422H | Recombinant Human POTEG protein, 146-306 aa, His-tagged | +Inquiry |
TACR2-8958M | Recombinant Mouse TACR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAP015A-025-2344S | Recombinant Staphylococcus aureus (strain: CDC61, other: HA-MRSA) SAP015A_025 protein, His-tagged | +Inquiry |
SPINK5-5582H | Recombinant Human SPINK5 Protein (Gly699-Ser830), N-His tagged | +Inquiry |
TMEM19-16971M | Recombinant Mouse TMEM19 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1790G | Active Native Griffonia Simplicifolia Lectin II Protein | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Testis-548E | Equine Testis Lysate, Total Protein | +Inquiry |
CSRP3-7229HCL | Recombinant Human CSRP3 293 Cell Lysate | +Inquiry |
ACAD10-14HCL | Recombinant Human ACAD10 cell lysate | +Inquiry |
CYP2C8-7114HCL | Recombinant Human CYP2C8 293 Cell Lysate | +Inquiry |
EDEM2-862HCL | Recombinant Human EDEM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FV3-053R Products
Required fields are marked with *
My Review for All FV3-053R Products
Required fields are marked with *
0
Inquiry Basket