Recombinant Full Length Frankia Alni Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged
Cat.No. : | RFL19475FF |
Product Overview : | Recombinant Full Length Frankia alni Prolipoprotein diacylglyceryl transferase(lgt) Protein (Q0RFY2) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Frankia alni |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MVFAAIPSPSRGVVHLGPVPLRAYALMIIIGIVVAVVVTGRRLRARGMDPALAGEIAYWA VPFGIVGARIYHVLSTPDAYFGEHGHVADVVKIWNGGLGIWGAIAGGALGAWLAARRLGI SLALFADAAAPGIILAQAIGRWGNWFNQELYGKPTTLPWAVRIDPAHRADPGVATYQPTF LYEFLWNLVVAAILLLVDRRHRLGRGRLFALYVALYTFGRLWIEMLRIDTADEILGLRVN IWTSAIVCVGAVVALLVVRRPVDPDVSPQEQRALGLVQDRTRRQPTDAAGETAGETRTAT RHDDATDGVDVNGADVDGADPSNVNGANVNGADPVNVNVNDADGAGAGAGEQPVAGAENG AAAVSSGRTRVERPPAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lgt |
Synonyms | lgt; FRAAL4966; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase |
UniProt ID | Q0RFY2 |
◆ Recombinant Proteins | ||
ANXA3-690R | Recombinant Rat ANXA3 Protein | +Inquiry |
GOLGA5-2616R | Recombinant Rat GOLGA5 Protein | +Inquiry |
UBA5-6043R | Recombinant Rat UBA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPRC5B-5538HF | Recombinant Full Length Human GPRC5B Protein | +Inquiry |
CNBPA-8060Z | Recombinant Zebrafish CNBPA | +Inquiry |
◆ Native Proteins | ||
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
VIM-186B | Native bovine VIM | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
ORM1-8016R | Native Rabbit Serum Alpha-1-Acid GlycoProtein | +Inquiry |
LOC102577615-59P | Native potato LOC102577615 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3H-6659HCL | Recombinant Human EIF3H 293 Cell Lysate | +Inquiry |
PRDX1-2882HCL | Recombinant Human PRDX1 293 Cell Lysate | +Inquiry |
CSAD-7252HCL | Recombinant Human CSAD 293 Cell Lysate | +Inquiry |
APOL4-99HCL | Recombinant Human APOL4 cell lysate | +Inquiry |
ANKRD29-8852HCL | Recombinant Human ANKRD29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lgt Products
Required fields are marked with *
My Review for All lgt Products
Required fields are marked with *
0
Inquiry Basket