Recombinant Full Length Flagellar Biosynthetic Protein Fliq(Fliq) Protein, His-Tagged
Cat.No. : | RFL21710CF |
Product Overview : | Recombinant Full Length Flagellar biosynthetic protein FliQ(fliQ) Protein (P0CF98) (1-89aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Clostridium Tetani |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-89) |
Form : | Lyophilized powder |
AA Sequence : | MSENMIMGVMRDAISTGLLVSAPILISAIVVGLLISILQATTQIQEQTLTFVPKLITVAL VGLFTGNWMLHNLVGLTNRIFELIANIVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fliQ |
Synonyms | fliQ; CTC_01661; Flagellar biosynthetic protein FliQ |
UniProt ID | P0CF98 |
◆ Recombinant Proteins | ||
MYOD1-10349M | Recombinant Mouse MYOD1 Protein | +Inquiry |
CHMP4C-1654M | Recombinant Mouse CHMP4C Protein, His (Fc)-Avi-tagged | +Inquiry |
RASA1-1779HFL | Recombinant Full Length Human RASA1 protein, Flag-tagged | +Inquiry |
RFL29204AF | Recombinant Full Length Anaeromyxobacter Sp. Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
SAOUHSC-00223-3697S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_00223 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOCS2-4260HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
FIBIN-6220HCL | Recombinant Human FIBIN 293 Cell Lysate | +Inquiry |
COL4A3-1219RCL | Recombinant Rat COL4A3 cell lysate | +Inquiry |
CA6-266HCL | Recombinant Human CA6 cell lysate | +Inquiry |
ITGA4-5133HCL | Recombinant Human ITGA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fliQ Products
Required fields are marked with *
My Review for All fliQ Products
Required fields are marked with *
0
Inquiry Basket