Recombinant Full Length Feline Coronavirus Membrane Protein(M) Protein, His-Tagged
Cat.No. : | RFL6223FF |
Product Overview : | Recombinant Full Length Feline coronavirus Membrane protein(M) Protein (P25878) (18-262aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | FCoV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-262) |
Form : | Lyophilized powder |
AA Sequence : | ERYCAMQDSGLQCINGTNSRCQTCFERGDLIWHLANWNFSWSVILIVFITVLQYGRPQFS WLVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGFSVAGAVVTFALWMMYFVRSV QLYRRTKSWWSFNPETNAILCVNALGRSYVLPLDGTPTGVTLTLLSGNLYAEGFKMAGGL TIEHLPKYVMIATPSRTIVYTLVGKQLKATTATGWAYYVKSKAGDYSTEARTDNLSEHEK LLHMV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | M |
Synonyms | M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein |
UniProt ID | P25878 |
◆ Recombinant Proteins | ||
BCMO1-2006HFL | Recombinant Full Length Human BCMO1 protein, Flag-tagged | +Inquiry |
MAP7D1-740H | Recombinant Human MAP7D1, GST-tagged | +Inquiry |
RFL27304AF | Recombinant Full Length Acinetobacter Baumannii Large-Conductance Mechanosensitive Channel(Mscl) Protein, His-Tagged | +Inquiry |
PAX8-12397M | Recombinant Mouse PAX8 Protein | +Inquiry |
ITM2B-2141R | Recombinant Rhesus Macaque ITM2B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
COL2A1-15C | Native Chicken COL2A1 Protein | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
Lectin-1806L | Active Native Lycopersicon Esculentum Lectin Protein | +Inquiry |
EPX-8107H | Native Human Eosinophil Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-212R | Rabbit Heart Lysate | +Inquiry |
HAUS1-5630HCL | Recombinant Human HAUS1 293 Cell Lysate | +Inquiry |
C17orf66-8232HCL | Recombinant Human C17orf66 293 Cell Lysate | +Inquiry |
CDK2AP2-7627HCL | Recombinant Human CDK2AP2 293 Cell Lysate | +Inquiry |
INSL3-5191HCL | Recombinant Human INSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All M Products
Required fields are marked with *
My Review for All M Products
Required fields are marked with *
0
Inquiry Basket