Recombinant Full Length Exiguobacterium Sibiricum Upf0754 Membrane Protein Exig_0680 (Exig_0680) Protein, His-Tagged
Cat.No. : | RFL26937EF |
Product Overview : | Recombinant Full Length Exiguobacterium sibiricum UPF0754 membrane protein Exig_0680 (Exig_0680) Protein (B1YK80) (1-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Exiguobacterium sibiricum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-378) |
Form : | Lyophilized powder |
AA Sequence : | MQVEVDLVIKMIGMIVIGALIGAVTNHLAIRMLFRPLEAKYIGKYRIPFTPGLIPKRRDE LAANLGRTVVKHLLTPEGISKRLQQPIVYQAITRMIQQEVQKWTRSTKTIREIAERFVAN PEGKLQQQIEQRIDQELESMAVAIKTARLTEVLGEGGTTKIKTAIPGMVEVLLHQTEQYF DSPAGKMKLEETVAQFIQSKLGGGMFGMLLANVNIVEMIQPELKRVIQGKSTHQFISEMV EQEVHTLLERTVGSLLEPEAERQIIERMKSEIVTRIPLAALLDTPLHEFLEPLEVRISQE MVPMLSKQMVNRLIEQVEQIMATLDLETIVREEVDLLDTAYLEEIVLSISRREFRAITWL GGLLGGLIGMIQAILLIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Exig_0680 |
Synonyms | Exig_0680; UPF0754 membrane protein Exig_0680 |
UniProt ID | B1YK80 |
◆ Recombinant Proteins | ||
Il7r-1247M | Recombinant Mouse Il7r Protein, MYC/DDK-tagged | +Inquiry |
Y66D12A.8-8246Z | Recombinant Zebrafish Y66D12A.8 | +Inquiry |
RFL20478PF | Recombinant Full Length Pan Paniscus Cytochrome B-C1 Complex Subunit Rieske, Mitochondrial(Uqcrfs1) Protein, His-Tagged | +Inquiry |
STK35L-1916Z | Recombinant Zebrafish STK35L | +Inquiry |
CSF2RA-27475TH | Recombinant Human CSF2RA | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
C3-02M | Native Monkey C3 Protein | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST2H3C-5515HCL | Recombinant Human HIST2H3C 293 Cell Lysate | +Inquiry |
SLC35B3-1630HCL | Recombinant Human SLC35B3 cell lysate | +Inquiry |
FAM131A-257HCL | Recombinant Human FAM131A lysate | +Inquiry |
EXOC4-6510HCL | Recombinant Human EXOC4 293 Cell Lysate | +Inquiry |
EFHB-6702HCL | Recombinant Human EFHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Exig_0680 Products
Required fields are marked with *
My Review for All Exig_0680 Products
Required fields are marked with *
0
Inquiry Basket