Recombinant Full Length Exiguobacterium Sibiricum Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL32031EF |
Product Overview : | Recombinant Full Length Exiguobacterium sibiricum Undecaprenyl-diphosphatase(uppP) Protein (B1YIX1) (1-278aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Exiguobacterium sibiricum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-278) |
Form : | Lyophilized powder |
AA Sequence : | MTIIELLKALLLGFIEGMTEFAPVSSTGHMIIVDDMWLQTTDFLGKYSANTFKIVIQLGS ILAVIVVFWKRLFSLIGLYKIEGEHDASGTHKLKLRHVLIGLLPAAVLGLLFEDFIDENL FSIDTVIIGLAAGAILMIAADKLGPKEPKTTSLDQISYRQAALVGLFQCISLWPGFSRSG STISGGVFLGMNHRTAADFTFIMAVPIMFGASALSLVKNWEYINVGDLGFYVVGFIASFG FALLSIRFFLKLINKIKLVPFAIYRLVLAAVLAVIVYM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Exig_0419; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | B1YIX1 |
◆ Recombinant Proteins | ||
LOR-3374H | Recombinant Human LOR Protein, His (Fc)-Avi-tagged | +Inquiry |
Met-4062MAF647 | Recombinant Mouse Met Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
IL1RL1-195H | Recombinant Human IL1RL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGFR-201H | Recombinant Human EGFR protein | +Inquiry |
PCSK9-406C | Recombinant Chinese hamster PCSK9 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
LYZ-249H | Active Native Human Lysozyme | +Inquiry |
Interferon alfa-P031H | Native Human interferon alpha therapeutic protein (Interferon alfa-n1) | +Inquiry |
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
FGG -32B | Native Bovine Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
NADK-3986HCL | Recombinant Human NADK 293 Cell Lysate | +Inquiry |
CTBS-7214HCL | Recombinant Human CTBS 293 Cell Lysate | +Inquiry |
RSPO1-1918HCL | Recombinant Human RSPO1 cell lysate | +Inquiry |
Thymus-149R | Rat Thymus Tissue Lysate | +Inquiry |
C14orf28-209HCL | Recombinant Human C14orf28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket